Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP3 Peptide - C-terminal region

NCBP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELG, C17orf85, HSA277841

UniProt

Q53F19

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061023

Preservative

Lyophilized powder

AA Sequence

RLGSAPKTKEKNTKKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP2 Human Gene Knockout Kit (CRISPR)
KN217988LP 1 Kit

AKAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fmoc-Arg (Pbf) TentaGel® R TRT Resin
RA1202.1G 1 g

Fmoc-Arg (Pbf) TentaGel® R TRT Resin

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
E-AB-30669-01 20 µL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
E-AB-30669-02 60 µL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
E-AB-30669-03 120 µL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
E-AB-30669-04 200 µL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details