Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YAE1 Peptide - C-terminal region

YAE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GK003, YAE1D1, C7orf36

UniProt

Q9NRH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YAE1 Rabbit Polyclonal Antibody (orb326796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064577

Preservative

Lyophilized powder

AA Sequence

SHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK1 delta, GST-Tag
79347 10 µg

CK1 delta, GST-Tag

Sign In for Pricing
View Details
MNK2 (MKNK2) (NM_199054) Human Over-expression Lysate
LC404728 20 µg

MNK2 (MKNK2) (NM_199054) Human Over-expression Lysate

Sign In for Pricing
View Details
TAB3 Antibody
orb1252833 100 µg

TAB3 Antibody

Sign In for Pricing
View Details
SLFNL1 Mouse Monoclonal Antibody [Clone 4F7]
E45M10426V-2 50 µL

SLFNL1 Mouse Monoclonal Antibody [Clone 4F7]

Sign In for Pricing
View Details
Mouse Ece1 / Endothelin-converting enzyme 1 Recombinant Protein
R9194m 1 Each

Mouse Ece1 / Endothelin-converting enzyme 1 Recombinant Protein

Sign In for Pricing
View Details
SCA23 sgRNA CRISPR Lentivector (Human) (Target 1)
K2093102 1.0 µg DNA

SCA23 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details