Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scrt1 Peptide - N-terminal region

Scrt1 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scrt1 Rabbit Polyclonal Antibody (orb324360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D4A919

Preservative

Lyophilized powder

AA Sequence

MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP10 Antibody
OACA06235-50UG 50 µg

MAP10 Antibody

Sign In for Pricing
View Details
GMP Human TGF-Beta 1 / TGFB1 Protein
GMP-TG1H25-1mg 1 mg

GMP Human TGF-Beta 1 / TGFB1 Protein

Sign In for Pricing
View Details
ANIB3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11906111 3x 1.0 µg

ANIB3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TPX2 Antibody
MBS7132309-01 0.1 mL

TPX2 Antibody

Sign In for Pricing
View Details
TPX2 Antibody
MBS7132309-02 5x 0.1 mL

TPX2 Antibody

Sign In for Pricing
View Details
CFHR2 Antibody
MBS1499581-01 0.05 mg

CFHR2 Antibody

Sign In for Pricing
View Details