Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scrt1 Peptide - N-terminal region

Scrt1 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scrt1 Rabbit Polyclonal Antibody (orb324360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D4A919

Preservative

Lyophilized powder

AA Sequence

MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Interleukin 1 Receptor Type II ELISA Kit
MBS073611 Inquire

Duck Interleukin 1 Receptor Type II ELISA Kit

Sign In for Pricing
View Details
Lamellipodin CRISPR Activation Plasmid (h)
sc-403034-ACT 20 µg

Lamellipodin CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
ALS2CL, ID (ALS2CL, ALS2 C-terminal-like protein) (PE)
MBS6273091-01 0.2 mL

ALS2CL, ID (ALS2CL, ALS2 C-terminal-like protein) (PE)

Sign In for Pricing
View Details
ALS2CL, ID (ALS2CL, ALS2 C-terminal-like protein) (PE)
MBS6273091-02 5x 0.2 mL

ALS2CL, ID (ALS2CL, ALS2 C-terminal-like protein) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal Feline Immunodeficiency Virus Antibody (NM3-6A9) [HRP]
NB100-66500H 0.1 mL

Mouse Monoclonal Feline Immunodeficiency Virus Antibody (NM3-6A9) [HRP]

Sign In for Pricing
View Details
C.I. Direct Black 17
596139 1.0g

C.I. Direct Black 17

Sign In for Pricing
View Details