Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPF1 Peptide - N-terminal region

HPF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf27

UniProt

Q9NWY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPF1 Rabbit Polyclonal Antibody (orb587078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060337

Preservative

Lyophilized powder

AA Sequence

GPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK2 Antibody (Biotin)
orb400879-01 50 µg

KLK2 Antibody (Biotin)

Sign In for Pricing
View Details
KLK2 Antibody (Biotin)
orb400879-02 100 µg

KLK2 Antibody (Biotin)

Sign In for Pricing
View Details
ELISA kit for Human ENG (Endoglin)
E-EL-H0062 96 Tests

ELISA kit for Human ENG (Endoglin)

Sign In for Pricing
View Details
Mars2 Mouse shRNA Lentiviral Particle (Locus ID 212679)
TL506355V 500 µL Each

Mars2 Mouse shRNA Lentiviral Particle (Locus ID 212679)

Sign In for Pricing
View Details
RND3 Protein Vector (Human) (pPB-N-His)
PV035398 500 ng

RND3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Guinea pig 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (AGPAT1) ELISA Kit
MBS2603925-01 48 Well

Guinea pig 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (AGPAT1) ELISA Kit

Sign In for Pricing
View Details