Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPF1 Peptide - N-terminal region

HPF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf27

UniProt

Q9NWY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPF1 Rabbit Polyclonal Antibody (orb587078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060337

Preservative

Lyophilized powder

AA Sequence

GPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Ephrin-A1/ EFNA1 Protein, His, Yeast-500ug
QP5964-ye-500ug 500ug

Recombinant Rat Ephrin-A1/ EFNA1 Protein, His, Yeast-500ug

Sign In for Pricing
View Details
Rabbit Thromboxane B1 ELISA kit
GTR10415899 96 Well

Rabbit Thromboxane B1 ELISA kit

Sign In for Pricing
View Details
Phospho-CCND3 (S264) Antibody
MBS9210340-01 0.08 mL

Phospho-CCND3 (S264) Antibody

Sign In for Pricing
View Details
Phospho-CCND3 (S264) Antibody
MBS9210340-02 0.4 mL

Phospho-CCND3 (S264) Antibody

Sign In for Pricing
View Details
Phospho-CCND3 (S264) Antibody
MBS9210340-03 5x 0.4 mL

Phospho-CCND3 (S264) Antibody

Sign In for Pricing
View Details
Small Capsomere-Interacting Protein (SCP) Antibody (HRP)
abx319910-01 20 µg

Small Capsomere-Interacting Protein (SCP) Antibody (HRP)

Sign In for Pricing
View Details