Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3L-AARSD1 Peptide - C-terminal region

PTGES3L-AARSD1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BTE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGES3L-AARSD1 Rabbit Polyclonal Antibody (orb326816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079543

Preservative

Lyophilized powder

AA Sequence

LLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clk2 Mouse Gene Knockout Kit (CRISPR)
KN503470 1 Kit

Clk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mix-n-StainTM CF®568 IgM Antibody Labeling Kits, 1x100ug labeling
#92567 1 Kit

Mix-n-StainTM CF®568 IgM Antibody Labeling Kits, 1x100ug labeling

Sign In for Pricing
View Details
OR10G6 Antibody
8G499-AAT 50 µg

OR10G6 Antibody

Sign In for Pricing
View Details
RRM2 Rabbit Monoclonal Antibody [Clone ID: SAIC-30C-18]
TA385903 200 µg

RRM2 Rabbit Monoclonal Antibody [Clone ID: SAIC-30C-18]

Sign In for Pricing
View Details
FOXA1 Recombinant Rabbit Monoclonal Antibody [JF10-02]
ET1702-89 100 µL

FOXA1 Recombinant Rabbit Monoclonal Antibody [JF10-02]

Sign In for Pricing
View Details
Carphedone
TRC-C184315-10MG 10 mg

Carphedone

Sign In for Pricing
View Details