Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3L-AARSD1 Peptide - C-terminal region

PTGES3L-AARSD1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BTE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGES3L-AARSD1 Rabbit Polyclonal Antibody (orb326816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079543

Preservative

Lyophilized powder

AA Sequence

LLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCN2 Rabbit Polyclonal Antibody
TA370172 100 µL

TCN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MS Rocking Shaker with 30 x 30 cm platform and flat non-slip rubber mat
MS-NRK-30 1 Unit

MS Rocking Shaker with 30 x 30 cm platform and flat non-slip rubber mat

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL
BNC041370-500 1x 500 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]
AM60018FC-N 100 µg

Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]

Sign In for Pricing
View Details
Polystyrene AM HMBA
H25031514.25G 25 g

Polystyrene AM HMBA

Sign In for Pricing
View Details
Butenafine Hydrochloride
TRC-B690195-5G 5 g

Butenafine Hydrochloride

Sign In for Pricing
View Details