Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap4s1 Peptide - N-terminal region

Ap4s1 Peptide - N-terminal region

Product Specifications

UniProt

F1M5X2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap4s1 Rabbit Polyclonal Antibody (orb581650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124471

Preservative

Lyophilized powder

AA Sequence

VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TL1A/ TNFSF15 Protein, Untagged, E.coli-100ug
QP10372-ec-100ug 100ug

Recombinant Human TL1A/ TNFSF15 Protein, Untagged, E.coli-100ug

Sign In for Pricing
View Details
Armenian Hamster Monoclonal anti-Mouse CD3e Antibody
xAP-0640 100 µg

Armenian Hamster Monoclonal anti-Mouse CD3e Antibody

Sign In for Pricing
View Details
CD45RA (158-4D3), 0.2mg/mL
BNUB0028-500 1x 500 µL

CD45RA (158-4D3), 0.2mg/mL

Sign In for Pricing
View Details
Anti-E. coli Antibody
15401-100 100ug

Anti-E. coli Antibody

Sign In for Pricing
View Details
HSPD1 Antibody
OACD00255-200UL 200 µL

HSPD1 Antibody

Sign In for Pricing
View Details
Peroxiredoxin 6 (PRDX6) Human qPCR Primer Pair (NM_004905)
HP208150 200 Reactions

Peroxiredoxin 6 (PRDX6) Human qPCR Primer Pair (NM_004905)

Sign In for Pricing
View Details