Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap4s1 Peptide - N-terminal region

Ap4s1 Peptide - N-terminal region

Product Specifications

UniProt

F1M5X2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap4s1 Rabbit Polyclonal Antibody (orb581650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124471

Preservative

Lyophilized powder

AA Sequence

VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PML shRNA (m) Lentiviral Particles
sc-36283-V 200 µL

PML shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
SMARCE1 Antibody (C-term)
MBS9209988-01 0.08 mL

SMARCE1 Antibody (C-term)

Sign In for Pricing
View Details
SMARCE1 Antibody (C-term)
MBS9209988-02 0.4 mL

SMARCE1 Antibody (C-term)

Sign In for Pricing
View Details
SMARCE1 Antibody (C-term)
MBS9209988-03 5x 0.4 mL

SMARCE1 Antibody (C-term)

Sign In for Pricing
View Details
Peripherin Polyclonal Antibody
PC-193 100 µL

Peripherin Polyclonal Antibody

Sign In for Pricing
View Details
SEPX1 ORF Vector (Human) (pORF)
ORF009360 1.0 µg DNA

SEPX1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details