Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLEC11 Peptide - N-terminal region

COLEC11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3MC2, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1

UniProt

Q9BWP8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLEC11 Rabbit Polyclonal Antibody (orb586967) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954705

Preservative

Lyophilized powder

AA Sequence

RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung: right lower lobe
CS710309 5x 5 µm

Tissue FFPE Sections, Lung: right lower lobe

Sign In for Pricing
View Details
Flumetralin
TRC-F455070-250MG 250 mg

Flumetralin

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS803755 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL
BNC043784-100 1x 100 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amplite® Fluorimetric Aldehyde Quantitation Kit
10052-AAT 200 Tests

Amplite® Fluorimetric Aldehyde Quantitation Kit

Sign In for Pricing
View Details
MTH1 (NUDT1) Human Gene Knockout Kit (CRISPR)
KN201148BN 1 Kit

MTH1 (NUDT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details