COLEC11 Peptide - N-terminal region
COLEC11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
3MC2, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1
UniProt
Q9BWP8
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COLEC11 Rabbit Polyclonal Antibody (orb586967) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_954705
Preservative
Lyophilized powder
AA Sequence
RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042337-100 1x 100 µL
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2912/imageurl/e-ab-f1089m.webp)
E-AB-F1089M-01 50 Tests
Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]
Sign In for Pricing
View Details E-AB-F1089M-02 100 Tests
Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]
Sign In for Pricing
View Details E-AB-F1089M-03 2x 100 Tests
Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]
Sign In for Pricing
View Details