Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf23 Peptide - middle region

C15orf23 Peptide - middle region

Product Specifications

Product Name Alternative

SKAP, TRAF4AF1, C15orf23

UniProt

Q9Y448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C15orf23 Rabbit Polyclonal Antibody (orb326843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150628

Preservative

Lyophilized powder

AA Sequence

TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS707974 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
HSPC150 (UBE2T) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]
TA501645AM 100 µL

HSPC150 (UBE2T) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
GUCY1A2 (NM_000855) Human Over-expression Lysate
LC424486 20 µg

GUCY1A2 (NM_000855) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CRP Antibody Pair Set
E-KAB-0018 50 µL & 100 µg

Human CRP Antibody Pair Set

Sign In for Pricing
View Details
C12orf43 (NM_022895) Human Recombinant Protein
TP304834M 100 µg

C12orf43 (NM_022895) Human Recombinant Protein

Sign In for Pricing
View Details
all-trans-13,14-Dihdyro Retinol
TRC-D449350-50MG 50 mg

all-trans-13,14-Dihdyro Retinol

Sign In for Pricing
View Details