Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf23 Peptide - middle region

C15orf23 Peptide - middle region

Product Specifications

Product Name Alternative

SKAP, TRAF4AF1, C15orf23

UniProt

Q9Y448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C15orf23 Rabbit Polyclonal Antibody (orb326843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150628

Preservative

Lyophilized powder

AA Sequence

TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcts2 (NM_025543) Mouse Tagged ORF Clone
MG201632 10 µg

Mcts2 (NM_025543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NAA25 Polyclonal Antibody
E-AB-13439-01 20 µL

NAA25 Polyclonal Antibody

Sign In for Pricing
View Details
NAA25 Polyclonal Antibody
E-AB-13439-02 60 µL

NAA25 Polyclonal Antibody

Sign In for Pricing
View Details
NAA25 Polyclonal Antibody
E-AB-13439-03 120 µL

NAA25 Polyclonal Antibody

Sign In for Pricing
View Details
NAA25 Polyclonal Antibody
E-AB-13439-04 200 µL

NAA25 Polyclonal Antibody

Sign In for Pricing
View Details
GABA A Receptor alpha 1 (GABRA1) (NM_001127647) Human Over-expression Lysate
LY426833 100 µg

GABA A Receptor alpha 1 (GABRA1) (NM_001127647) Human Over-expression Lysate

Sign In for Pricing
View Details