Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrtc2 Peptide - C-terminal region

Dmrtc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933432E21Rik, Dmrt7

UniProt

Q8CGW9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmrtc2 Rabbit Polyclonal Antibody (orb576292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082008

Preservative

Lyophilized powder

AA Sequence

SCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-1 Knockout 143B Polyclonal Cells
ARG11855 1 Million

NKX2-1 Knockout 143B Polyclonal Cells

Sign In for Pricing
View Details
2-Iodophenol
GK4274-25g 25 g

2-Iodophenol

Sign In for Pricing
View Details
Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS745014-01 48 Well

Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS745014-02 96 Well

Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS745014-03 5x 96 Well

Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS745014-04 10x 96 Well

Bovine Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details