Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll1 Peptide - C-terminal region

Vgll1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Tondu

UniProt

Q99NC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vgll1 Rabbit Polyclonal Antibody (orb576470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573514

Preservative

Lyophilized powder

AA Sequence

PEVYRVFPDRHLTPEVYHVFPDRHLTPEVYPDGRCGPLQHLVQQDRYQNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHFP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
26497061 1.0 µg DNA

LHFP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human TMX2
MBS7611715-01 0.05 mg

Recombinant Human TMX2

Sign In for Pricing
View Details
Recombinant Human TMX2
MBS7611715-02 0.2 mg

Recombinant Human TMX2

Sign In for Pricing
View Details
Recombinant Human TMX2
MBS7611715-03 1 mg

Recombinant Human TMX2

Sign In for Pricing
View Details
Recombinant Human TMX2
MBS7611715-04 5x 1 mg

Recombinant Human TMX2

Sign In for Pricing
View Details
CYP2W1 ORF Vector (Human) (pORF)
17437011 1.0 µg DNA

CYP2W1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details