Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll1 Peptide - C-terminal region

Vgll1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Tondu

UniProt

Q99NC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vgll1 Rabbit Polyclonal Antibody (orb576470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573514

Preservative

Lyophilized powder

AA Sequence

PEVYRVFPDRHLTPEVYHVFPDRHLTPEVYPDGRCGPLQHLVQQDRYQNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPOR Rabbit Polyclonal Antibody (BF350)
orb1597856 100 µL

TPOR Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
beta B1 Crystallin (CRYBB1) (NM_001887) Human Mass Spec Standard
PH307718 10 µg

beta B1 Crystallin (CRYBB1) (NM_001887) Human Mass Spec Standard

Sign In for Pricing
View Details
HSD17B13 Conjugated Antibody
C36534 100 µL

HSD17B13 Conjugated Antibody

Sign In for Pricing
View Details
PHD2 Antibody
MBS9613565-01 0.1 mL

PHD2 Antibody

Sign In for Pricing
View Details
PHD2 Antibody
MBS9613565-02 0.2 mL

PHD2 Antibody

Sign In for Pricing
View Details
PHD2 Antibody
MBS9613565-03 5x 0.2 mL

PHD2 Antibody

Sign In for Pricing
View Details