Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uchl1 Peptide - middle region

Uchl1 Peptide - middle region

Product Specifications

UniProt

Q00981

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058933

Preservative

Lyophilized powder

AA Sequence

NNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate
B11713-01 1 g

N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate

Sign In for Pricing
View Details
N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate
B11713-02 5 g

N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate

Sign In for Pricing
View Details
N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate
B11713-03 25 g

N, N-bis (3-Aminopropyl) -1,4-butanediamine phosphate

Sign In for Pricing
View Details
Lentiviral human PRKAR2A sgRNA gene knockout kit - Lentiviral human PRKAR2A sgRNA gene knockout kit (100)
GTR15399277 1 Vial

Lentiviral human PRKAR2A sgRNA gene knockout kit - Lentiviral human PRKAR2A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ACTR2 Antibody (C-term) Blocking Peptide
MBS9226135-01 0.5 mg

ACTR2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
ACTR2 Antibody (C-term) Blocking Peptide
MBS9226135-02 5x 0.5 mg

ACTR2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details