Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3G Peptide - middle region

POLR3G Peptide - middle region

Product Specifications

Product Name Alternative

RPC32, RPC7

UniProt

O15318

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR3G Rabbit Polyclonal Antibody (orb587042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006458

Preservative

Lyophilized powder

AA Sequence

SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calpain 1/CAPN1 Antibody Picoband® (Dylight488 Conjugate)
PA1364-Dylight488 100 µg

Anti-Calpain 1/CAPN1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Serpina3k (NM_011458) Mouse Untagged Clone
MC204524 10 µg

Serpina3k (NM_011458) Mouse Untagged Clone

Sign In for Pricing
View Details
PDE8A Antibody
A52642-100UL 100 µL

PDE8A Antibody

Sign In for Pricing
View Details
GTP 100mM Tris Solution
GTP001T-1 1 mL

GTP 100mM Tris Solution

Sign In for Pricing
View Details
Human Anti-Zika Virus IgM (Anti-ZV-IgM) ELISA Kit
SLY3115Hu-01 96 Tests

Human Anti-Zika Virus IgM (Anti-ZV-IgM) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Zika Virus IgM (Anti-ZV-IgM) ELISA Kit
SLY3115Hu-02 48 Tests

Human Anti-Zika Virus IgM (Anti-ZV-IgM) ELISA Kit

Sign In for Pricing
View Details