Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3G Peptide - middle region

POLR3G Peptide - middle region

Product Specifications

Product Name Alternative

RPC32, RPC7

UniProt

O15318

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR3G Rabbit Polyclonal Antibody (orb587042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006458

Preservative

Lyophilized powder

AA Sequence

SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC1005672-01 250 mg

2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC1005672-02 1 g

2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC1005672-03 5 g

2- (2,2-Difluorobenzo[d][1,3]dioxol-5-yl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
KAT13A Rabbit Monoclonal Antibody
E56G4072 100 µL

KAT13A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
KLHL29 AAV Vector (Rat) (CMV)
25792106 1 µg

KLHL29 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
IGFBP4 polyclonal antibody
BS7714-01 50 µL

IGFBP4 polyclonal antibody

Sign In for Pricing
View Details