Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf66 Peptide - N-terminal region

C19orf66 Peptide - N-terminal region

Product Specifications

UniProt

Q9NUL5

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C19orf66 Rabbit Polyclonal Antibody (orb587087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060851

Preservative

Lyophilized powder

AA Sequence

FGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex21 Mouse Gene Knockout Kit (CRISPR)
KN517437 1 Kit

Tex21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GREM1 (Gremlin 1) CLIA Kit
E-CL-H0888-01 24 Tests

Human GREM1 (Gremlin 1) CLIA Kit

Sign In for Pricing
View Details
Human GREM1 (Gremlin 1) CLIA Kit
E-CL-H0888-02 48 Tests

Human GREM1 (Gremlin 1) CLIA Kit

Sign In for Pricing
View Details
Human GREM1 (Gremlin 1) CLIA Kit
E-CL-H0888-03 96 Tests

Human GREM1 (Gremlin 1) CLIA Kit

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL
BNC880807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse TREML2/TLT2 Protein (His Tag)
PKSM041173-01 10 µg

Recombinant Mouse TREML2/TLT2 Protein (His Tag)

Sign In for Pricing
View Details