C19orf66 Peptide - N-terminal region
C19orf66 Peptide - N-terminal region
Product Specifications
UniProt
Q9NUL5
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C19orf66 Rabbit Polyclonal Antibody (orb587087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060851
Preservative
Lyophilized powder
AA Sequence
FGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419853 100 µg
INPP5F (OCRL) (NM_001587) Human Over-expression Lysate
Sign In for Pricing
View Details ![Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea172e8/imageurl/ta504368bm.webp)
TA504368BM 100 µL
Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]
Sign In for Pricing
View Details ![Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1ccc9/imageurl/ta805899bm.webp)
TA805899BM 100 µL
Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]
Sign In for Pricing
View Details 
LC424745 20 µg
Cathepsin K (CTSK) (NM_000396) Human Over-expression Lysate
Sign In for Pricing
View Details