C22orf13 Peptide - middle region
C22orf13 Peptide - middle region
Product Specifications
Product Name Alternative
LLN4, C22orf13
UniProt
Q96NT3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C22orf13 Rabbit Polyclonal Antibody (orb587153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_113632
Preservative
Lyophilized powder
AA Sequence
RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
S1100 1 Each
Free seat for hosting 100% off (4 or 5 day Workshops ONLY)
Sign In for Pricing
View Details 
168827-AF-PE 100 µL
Melanoma Marker (MART-1 + Tyrosinase + gp100, Melanoma antigen recognized by T-cells 1 (MART-1), MLAN-A, TYR, PMEL17) (PE)
Sign In for Pricing
View Details 
K1718807 1.0 µg DNA
PRG3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details