C22orf13 Peptide - middle region
C22orf13 Peptide - middle region
Product Specifications
Product Name Alternative
LLN4, C22orf13
UniProt
Q96NT3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C22orf13 Rabbit Polyclonal Antibody (orb587153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_113632
Preservative
Lyophilized powder
AA Sequence
RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-9705R-APC-Cy7 100 µL
ITM2A Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details 
ARP74924_P050-Biotin 100 µL
TNFRSF8 Antibody - middle region : Biotin (ARP74924_P050-Biotin)
Sign In for Pricing
View Details MBS650397-01 0.025 mg
Epidermal Growth Factor, Pro-, Recombinant, Mouse (Pro-EGF, EGF) (BSA Free)
Sign In for Pricing
View Details MBS650397-02 5x 0.025 mg
Epidermal Growth Factor, Pro-, Recombinant, Mouse (Pro-EGF, EGF) (BSA Free)
Sign In for Pricing
View Details