Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC159 Peptide - C-terminal region

CCDC159 Peptide - C-terminal region

Product Specifications

UniProt

P0C7I6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC159 Rabbit Polyclonal Antibody (orb326863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073972

Preservative

Lyophilized powder

AA Sequence

CRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Mpro-IN-35
HY-170545 1 Each

SARS-CoV-2 Mpro-IN-35

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0976 (TP_0976), partial
MBS7070562 Inquire

Recombinant Treponema pallidum Uncharacterized protein TP_0976 (TP_0976), partial

Sign In for Pricing
View Details
MUC1 Knockout Raji Polyclonal Cells
ARG0990 1 Million

MUC1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
ATP1A4 discontinued
530238-01 20 µL

ATP1A4 discontinued

Sign In for Pricing
View Details
ATP1A4 discontinued
530238-02 100 µL

ATP1A4 discontinued

Sign In for Pricing
View Details
AccuRapidTM Cell-Free Protein Expression Kit
K-7250 45 μL x 24 Reactions

AccuRapidTM Cell-Free Protein Expression Kit

Sign In for Pricing
View Details