Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC159 Peptide - C-terminal region

CCDC159 Peptide - C-terminal region

Product Specifications

UniProt

P0C7I6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC159 Rabbit Polyclonal Antibody (orb326863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073972

Preservative

Lyophilized powder

AA Sequence

CRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit
MBS9900148-01 48 Well

Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit

Sign In for Pricing
View Details
Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit
MBS9900148-02 96 Well

Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit

Sign In for Pricing
View Details
Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit
MBS9900148-03 5x 96 Well

Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit

Sign In for Pricing
View Details
Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit
MBS9900148-04 10x 96 Well

Canine NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit

Sign In for Pricing
View Details
Sheep Retinol Binding Protein ELISA Kit
MBS031800-01 48 Well

Sheep Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Retinol Binding Protein ELISA Kit
MBS031800-02 96 Well

Sheep Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details