Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEAN1 Peptide - C-terminal region

BEAN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BEAN, SCA31

UniProt

Q3B7T3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEAN1 Rabbit Polyclonal Antibody (orb326873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171491

Preservative

Lyophilized powder

AA Sequence

TDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MESP2 Mouse mAb
MBS8538989-01 0.1 mL

MESP2 Mouse mAb

Sign In for Pricing
View Details
MESP2 Mouse mAb
MBS8538989-02 0.1 mL (AF405L)

MESP2 Mouse mAb

Sign In for Pricing
View Details
MESP2 Mouse mAb
MBS8538989-03 0.1 mL (AF405S)

MESP2 Mouse mAb

Sign In for Pricing
View Details
MESP2 Mouse mAb
MBS8538989-04 0.1 mL (AF610)

MESP2 Mouse mAb

Sign In for Pricing
View Details
MESP2 Mouse mAb
MBS8538989-05 0.1 mL (AF635)

MESP2 Mouse mAb

Sign In for Pricing
View Details
MESP2 Mouse mAb
MBS8538989-06 0.1 mL (APC)

MESP2 Mouse mAb

Sign In for Pricing
View Details