Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEAN1 Peptide - C-terminal region

BEAN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BEAN, SCA31

UniProt

Q3B7T3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEAN1 Rabbit Polyclonal Antibody (orb326873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171491

Preservative

Lyophilized powder

AA Sequence

TDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1732802 1.0 µg DNA

PRSS1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued
213595-01 50 µL

STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued

Sign In for Pricing
View Details
STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued
213595-02 100 µL

STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued

Sign In for Pricing
View Details
STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued
213595-03 200 µL

STAT2 (Signal Transducer and Activator of Transcription 2, ISGF-3, MGC59816, P113, STAT113) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal AIF AIFM1 Antibody (Human, Mouse, Rat)
B2021269 100 µL

Rabbit Monoclonal AIF AIFM1 Antibody (Human, Mouse, Rat)

Sign In for Pricing
View Details
TMEM131 Antibody () Blocking peptide
orb1456887 500 µg

TMEM131 Antibody () Blocking peptide

Sign In for Pricing
View Details