Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF9 Peptide - N-terminal region

KLF9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BTEB, BTEB1

UniProt

Q13886

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLF9 Rabbit Polyclonal Antibody (orb573770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001197

Preservative

Lyophilized powder

AA Sequence

LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RORB Pre-designed siRNA Set A
SI013941A 1 Each

Human RORB Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPL19P19 siRNA Oligos set (Human)
40962171 3x 5 nmol

RPL19P19 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human COX10 (NM_001303) AAV Particle
RC200624A1V 250 µL

Human COX10 (NM_001303) AAV Particle

Sign In for Pricing
View Details
AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR4G5]
TA591069S 30 µL

AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR4G5]

Sign In for Pricing
View Details
RSRC1 Antibody
E51A07959 100 µL

RSRC1 Antibody

Sign In for Pricing
View Details
PNK / PNKP Rabbit Monoclonal Antibody
E46F2431 40 µL

PNK / PNKP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details