Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF9 Peptide - N-terminal region

KLF9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BTEB, BTEB1

UniProt

Q13886

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLF9 Rabbit Polyclonal Antibody (orb573770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001197

Preservative

Lyophilized powder

AA Sequence

LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse Defensin Beta 2 (DEFb2) Polyclonal Antibody
VD1N276 1 Each

Rabbit Anti-Mouse Defensin Beta 2 (DEFb2) Polyclonal Antibody

Sign In for Pricing
View Details
KCNJ18 Rabbit pAb, BF700 conjugated
orb2852772 100 µL

KCNJ18 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
PNLDC1 (NM_173516) Human Tagged ORF Clone Lentiviral Particle
RC221944L3V 200 µL

PNLDC1 (NM_173516) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TMEM57 Protein Vector (Rat) (pPB-C-His)
PV311782 500 ng

TMEM57 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Arylsulfatase D antibody
STJ71526 100 µg

Anti-Arylsulfatase D antibody

Sign In for Pricing
View Details
Recombinant Aedes albopictus La protein homolog
MBS1466569-01 0.02 mg (E-Coli)

Recombinant Aedes albopictus La protein homolog

Sign In for Pricing
View Details