HMOX1 Peptide - N-terminal region
HMOX1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HO-1, HSP32, bK286B10
UniProt
P09601
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMOX1 Rabbit Polyclonal Antibody (orb579414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002124
Preservative
Lyophilized powder
AA Sequence
ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C424853-5MG 5 mg
(E/Z)-Chlorprothixene-d6 Hydrochloride (Mixture)
Sign In for Pricing
View Details 
BNC740133-100 1x 100 µL
Hepatocyte Specific Antigen (HSA133), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![RAX Mouse Monoclonal Antibody [Clone ID: OTI1C5]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a00/imageurl/cf811003.webp)
BNC042755-100 1x 100 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details