Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMOX1 Peptide - N-terminal region

HMOX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HO-1, HSP32, bK286B10

UniProt

P09601

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMOX1 Rabbit Polyclonal Antibody (orb579414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002124

Preservative

Lyophilized powder

AA Sequence

ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xantphos Pd G3
TRC-X144580-50MG 50 mg

Xantphos Pd G3

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F11040-01 100 µg

AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F11040-02 1 mg

AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F11040-03 5 mg

AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F11040-04 25 mg

AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F11040-05 50 mg

AF/LE Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details