Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3L2 Peptide - middle region

MBD3L2 Peptide - middle region

Product Specifications

UniProt

Q8NHZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBD3L2 Rabbit Polyclonal Antibody (orb586555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653215

Preservative

Lyophilized powder

AA Sequence

EHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (AD2)
NBP2-48480SS 0.025 mL

Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (AD2)

Sign In for Pricing
View Details
K1KB3 Polyclonal Antibody
E-AB-40368-01 20 µL

K1KB3 Polyclonal Antibody

Sign In for Pricing
View Details
K1KB3 Polyclonal Antibody
E-AB-40368-02 60 µL

K1KB3 Polyclonal Antibody

Sign In for Pricing
View Details
K1KB3 Polyclonal Antibody
E-AB-40368-03 120 µL

K1KB3 Polyclonal Antibody

Sign In for Pricing
View Details
K1KB3 Polyclonal Antibody
E-AB-40368-04 200 µL

K1KB3 Polyclonal Antibody

Sign In for Pricing
View Details
Normal rat IgG1-PE
sc-2871 200 µg/mL

Normal rat IgG1-PE

Sign In for Pricing
View Details