Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3L2 Peptide - middle region

MBD3L2 Peptide - middle region

Product Specifications

UniProt

Q8NHZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBD3L2 Rabbit Polyclonal Antibody (orb586555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653215

Preservative

Lyophilized powder

AA Sequence

EHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI2 (Tissue Factor Pathway Inhibitor 2) Guinea Pig ELISA Kit
H5498 96 Tests

TFPI2 (Tissue Factor Pathway Inhibitor 2) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
NFκBP65
PA1125 100μg

NFκBP65

Sign In for Pricing
View Details
LAMC3 Antibody - C-terminal region
MBS3216913-01 0.1 mL

LAMC3 Antibody - C-terminal region

Sign In for Pricing
View Details
LAMC3 Antibody - C-terminal region
MBS3216913-02 5x 0.1 mL

LAMC3 Antibody - C-terminal region

Sign In for Pricing
View Details
Arhgef17 (NM_001081116) Mouse Tagged ORF Clone
MG217055 10 µg

Arhgef17 (NM_001081116) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PCytochrome C-GFP
ELKP756 20 µL Plasmid

PCytochrome C-GFP

Sign In for Pricing
View Details