C9orf57 Peptide - N-terminal region
C9orf57 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RP11-346E17.3
UniProt
Q5W0N0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C9orf57 Rabbit Polyclonal Antibody (orb587223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001122090
Preservative
Lyophilized powder
AA Sequence
GLEIRMRRIVFAGVILFRLLGVILFRLLGVILFGRLGDLGTCQTKPGQYW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472044-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881131-500 1x 500 µL
CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471025-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680421-500 1x 500 µL
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details