Figla Peptide - C-terminal region
Figla Peptide - C-terminal region
Product Specifications
Product Name Alternative
BHLHc8
UniProt
O55208
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Figla Rabbit Polyclonal Antibody (orb576230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036143
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI4F1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908412/imageurl/cf808371.webp)
CF808371 100 µg
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI4F1]
Sign In for Pricing
View Details 
BNC682085-100 1x 100 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
