Figla Peptide - C-terminal region
Figla Peptide - C-terminal region
Product Specifications
Product Name Alternative
BHLHc8
UniProt
O55208
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Figla Rabbit Polyclonal Antibody (orb576230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036143
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401911-100 1x 100 µL
ROR2 (ROR2/1911), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PSMD13 Recombinant Rabbit Monoclonal Antibody [PSH0-52]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81001/imageurl/ha721399.webp)
HA721399 100 µL
PSMD13 Recombinant Rabbit Monoclonal Antibody [PSH0-52]
Sign In for Pricing
View Details 
AP02558PU-S 50 µL
NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 