Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx2 Peptide - C-terminal region

Zhx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Afr-1, Afr1, Raf, mKIAA0854

UniProt

Q8C0C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zhx2 Rabbit Polyclonal Antibody (orb329946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955520

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGRDAVSRKVAKQVAESPKNGSEAAHQYAKDPKALSEEDSEKLVPRMKVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL1 + T200/797), 1mg/mL
BNUM1209-50 1x 50 µL

CD45RO (UCHL1 + T200/797), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Seminal vesicle
CS505197 5x 5 µm

Frozen Tissue Sections, Seminal vesicle

Sign In for Pricing
View Details
Recombinant Human CD112/Nectin-2 Protein
PKSH031939 100 µg

Recombinant Human CD112/Nectin-2 Protein

Sign In for Pricing
View Details
Minodronic Acid
TRC-M344900-50MG 50 mg

Minodronic Acid

Sign In for Pricing
View Details
5-Nitropyridine-3,4-diamine
TRC-B506335-50MG 50 mg

5-Nitropyridine-3,4-diamine

Sign In for Pricing
View Details
CDC25A pSer75 Rabbit Polyclonal Antibody
AP20807PU-N 100 µg

CDC25A pSer75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details