Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx2 Peptide - C-terminal region

Zhx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Afr-1, Afr1, Raf, mKIAA0854

UniProt

Q8C0C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zhx2 Rabbit Polyclonal Antibody (orb329946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955520

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGRDAVSRKVAKQVAESPKNGSEAAHQYAKDPKALSEEDSEKLVPRMKVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL2 Rabbit Polyclonal Antibody
AP20434PU-N 100 µg

ELAVL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
trans-Nerolidol
TRC-N385710-500MG 500 mg

trans-Nerolidol

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) (NM_001030003) Human Over-expression Lysate
LY422283 100 µg

HNF 4 alpha (HNF4A) (NM_001030003) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM185B (NR_000034) Human Over-expression Lysate
LY403753 100 µg

TMEM185B (NR_000034) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NADK activation kit by CRISPRa
GA112247 1 Kit

Human NADK activation kit by CRISPRa

Sign In for Pricing
View Details
1-Benzyl D-1,2-azetidinedicarboxylate-d5 with L-Hydrazide Tyrosine
TRC-B194108-5MG 5 mg

1-Benzyl D-1,2-azetidinedicarboxylate-d5 with L-Hydrazide Tyrosine

Sign In for Pricing
View Details