Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rassf5 Peptide - C-terminal region

Rassf5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1300019G20Rik, AU042887, Maxp1, Nore1, Nore1A, Nore1B, Rapl

UniProt

Q5EBH1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rassf5 Rabbit Polyclonal Antibody (orb584411) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061220

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem51 (NM_145402) Mouse Recombinant Protein
TP503181 20 µg

Tmem51 (NM_145402) Mouse Recombinant Protein

Sign In for Pricing
View Details
ORMDL1 shRNA Plasmid (m)
sc-151314-SH 20 µg

ORMDL1 shRNA Plasmid (m)

Sign In for Pricing
View Details
IgG, Fc, X-Adsorbed (TRITC) discontinued
I1904-46X6 500 µg

IgG, Fc, X-Adsorbed (TRITC) discontinued

Sign In for Pricing
View Details
STAT6 peptide
orb217982-01 1 mg

STAT6 peptide

Sign In for Pricing
View Details
STAT6 peptide
orb217982-02 5 mg

STAT6 peptide

Sign In for Pricing
View Details
Mouse Nrm Pre-designed siRNA Set A
SI109595A 1 Each

Mouse Nrm Pre-designed siRNA Set A

Sign In for Pricing
View Details