BNIP2 Peptide - middle region
BNIP2 Peptide - middle region
Product Specifications
Product Name Alternative
BNIP-2, NIP2
UniProt
J3KN59
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BNIP2 Rabbit Polyclonal Antibody (orb585146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004321
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H08510-2 20 µg
HRASLS3 (PLA2G16) (NM_007069) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6335278-01 0.2 mL
PNKP, NT (PNKP, Bifunctional polynucleotide phosphatase/kinase, DNA 5'-kinase/3'-phosphatase, Polynucleotide kinase-3'-phosphatase, Polynucleotide 3'-phosphatase, 2'(3')-polynucleotidase, Polynucleotide 5'-hydroxyl-kinase) (PE)
Sign In for Pricing
View Details MBS6335278-02 5x 0.2 mL
PNKP, NT (PNKP, Bifunctional polynucleotide phosphatase/kinase, DNA 5'-kinase/3'-phosphatase, Polynucleotide kinase-3'-phosphatase, Polynucleotide 3'-phosphatase, 2'(3')-polynucleotidase, Polynucleotide 5'-hydroxyl-kinase) (PE)
Sign In for Pricing
View Details