BNIP2 Peptide - middle region
BNIP2 Peptide - middle region
Product Specifications
Product Name Alternative
BNIP-2, NIP2
UniProt
J3KN59
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BNIP2 Rabbit Polyclonal Antibody (orb585146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004321
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6446871-01 0.1 mL
GPAM (GPAT, GPAT1, Glycerol-3-phosphate Acyltransferase, Mitochondrial) (MaxLight 405)
Sign In for Pricing
View Details MBS6446871-02 5x 0.1 mL
GPAM (GPAT, GPAT1, Glycerol-3-phosphate Acyltransferase, Mitochondrial) (MaxLight 405)
Sign In for Pricing
View Details 
orb2811115-01 48 Tests
Human high sensitivity C-Reactive Protein (hs-CRP) ELISA Kit
Sign In for Pricing
View Details orb2811115-02 96 Tests
Human high sensitivity C-Reactive Protein (hs-CRP) ELISA Kit
Sign In for Pricing
View Details orb2811115-03 5 x 96 T
Human high sensitivity C-Reactive Protein (hs-CRP) ELISA Kit
Sign In for Pricing
View Details