CD1C Peptide - C-terminal region
CD1C Peptide - C-terminal region
Product Specifications
Product Name Alternative
BDCA1, CD1, CD1A, R7
UniProt
P29017
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD1C Rabbit Polyclonal Antibody (orb585621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001756
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15363345 1 Vial
Lentiviral human TRAF4 sgRNA gene knockout kit - Lentiviral human TRAF4 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 
