Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH1 Peptide - N-terminal region

ARMH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P40, C1orf228, NCRNA00082

UniProt

Q6PIY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMH1 Rabbit Polyclonal Antibody (orb587285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFRD1 Protein Lysate
MBS8413374-01 0.02 mg

Human IFRD1 Protein Lysate

Sign In for Pricing
View Details
Human IFRD1 Protein Lysate
MBS8413374-02 5x 0.02 mg

Human IFRD1 Protein Lysate

Sign In for Pricing
View Details
Research Grade Retatrutide
DPE40104 5 mg

Research Grade Retatrutide

Sign In for Pricing
View Details
RBM6 antibody
70R-7865 50 ug

RBM6 antibody

Sign In for Pricing
View Details
HEL308 Protein Vector (Human) (pPM-C-HA)
PV019403 500 ng

HEL308 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Romo1 ELISA Kit
EF013312 96 Tests

Mouse Romo1 ELISA Kit

Sign In for Pricing
View Details