Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH1 Peptide - N-terminal region

ARMH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P40, C1orf228, NCRNA00082

UniProt

Q6PIY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMH1 Rabbit Polyclonal Antibody (orb587285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human WFDC11 Protein
E30P12559 20 µg

Recombinant Human WFDC11 Protein

Sign In for Pricing
View Details
IRAK1BP1 (NM_001010844) Human Over-expression Lysate
LY423178 100 µg

IRAK1BP1 (NM_001010844) Human Over-expression Lysate

Sign In for Pricing
View Details
NNO1 AAV siRNA Pooled Vector
31967161 1.0 µg

NNO1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (006) [Alexa Fluor 532]
NBP2-89404AF532 0.1 mL

Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (006) [Alexa Fluor 532]

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Apolipoprotein B100 (APOB100)
MBS2130428-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Apolipoprotein B100 (APOB100)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Apolipoprotein B100 (APOB100)
MBS2130428-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Apolipoprotein B100 (APOB100)

Sign In for Pricing
View Details