CNPPD1 Peptide - N-terminal region
CNPPD1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C2orf24, CGI-57
UniProt
Q9BV87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNPPD1 Rabbit Polyclonal Antibody (orb331386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056495
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P015-R616-125 1x 125 µL
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), RPE-AstralTM616 Conjugate - Biotium Choice
Sign In for Pricing
View Details 
