CNPPD1 Peptide - N-terminal region
CNPPD1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C2orf24, CGI-57
UniProt
Q9BV87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNPPD1 Rabbit Polyclonal Antibody (orb331386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056495
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP51902PU-N 400 µL
Glypican 3 (GPC3) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![MOX1 (MEOX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C5]](https://cdn.genprice.uk/products/937/68dd1b7b061270361ea1c429/imageurl/ta804737am.webp)
TA804737AM 100 µL
MOX1 (MEOX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C5]
Sign In for Pricing
View Details 
BNC403135-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3135R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 