Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gprc5d Peptide - C-terminal region

Gprc5d Peptide - C-terminal region

Product Specifications

UniProt

Q9JIL6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gprc5d Rabbit Polyclonal Antibody (orb586684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001192325

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP4-1 activation kit by CRISPRa
GA113838 1 Kit

Human KRTAP4-1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR561593 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
PDCD4 Mouse Monoclonal Antibody [Clone ID: k4C1]
AM09026PU-N 100 µL

PDCD4 Mouse Monoclonal Antibody [Clone ID: k4C1]

Sign In for Pricing
View Details
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
TA380190 100 µL

Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bromophenol Blue
HS-603 10 g

Bromophenol Blue

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802149 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details