Gprc5d Peptide - C-terminal region
Gprc5d Peptide - C-terminal region
Product Specifications
UniProt
Q9JIL6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gprc5d Rabbit Polyclonal Antibody (orb586684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001192325
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Human CCL25 Recombinant Rabbit Monoclonal Antibody [PSH08-66] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82993/imageurl/ha723016.webp)
HA723016 100 µL
Human CCL25 Recombinant Rabbit Monoclonal Antibody [PSH08-66] - BSA and Azide free (Detector)
Sign In for Pricing
View Details 
BNC470334-100 1x 100 µL
Cytokeratin 8 (H1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
