Psmg2 Peptide - middle region
Psmg2 Peptide - middle region
Product Specifications
Product Name Alternative
1700017I17Rik, AW545363, Clast3, Tnfsf5ip1
UniProt
Q9EST4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Psmg2 Rabbit Polyclonal Antibody (orb586886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598899
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
More Discoveries
Explore Other Products
Browse additional items from our catalog
46949066 1.0 µg DNA
TMEM179B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
23678141 1x 10^6 Cells / 1.0 mL
HMHA1 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details abx151935-01 96 Tests
Human Interleukin 1 Receptor Antagonist (IL1RN) ELISA Kit
Sign In for Pricing
View Details 
abx151935-02 5x 96 Tests
Human Interleukin 1 Receptor Antagonist (IL1RN) ELISA Kit
Sign In for Pricing
View Details 
abx151935-03 10x 96 Tests
Human Interleukin 1 Receptor Antagonist (IL1RN) ELISA Kit
Sign In for Pricing
View Details